PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G29380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 337aa    MW: 36727 Da    PI: 5.6592
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G29380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.3e-092472802255
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yps+ e++ LA+++gL+ +q+ +WF N+R ++
  OGLUM03G29380.1 247 WPYPSELEKAALAESTGLDAKQINNWFINQRKRH 280
                      59*****************************885 PP

2ELK35.71.8e-12200221122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK +Ll+KYsgyL+sL+ E+s
  OGLUM03G29380.1 200 ELKSHLLNKYSGYLSSLWRELS 221
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.8E-2260104IPR005540KNOX1
PfamPF037907.1E-2261102IPR005540KNOX1
SMARTSM012562.8E-27110161IPR005541KNOX2
PfamPF037913.3E-22115160IPR005541KNOX2
PROSITE profilePS5121310.353200220IPR005539ELK domain
SMARTSM011884.0E-7200221IPR005539ELK domain
PfamPF037892.0E-9200221IPR005539ELK domain
PROSITE profilePS5007112.455220283IPR001356Homeobox domain
SuperFamilySSF466891.58E-18221293IPR009057Homeodomain-like
SMARTSM003899.5E-12222287IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-25225284IPR009057Homeodomain-like
CDDcd000864.97E-12229283No hitNo description
PfamPF059207.4E-16240279IPR008422Homeobox KN domain
PROSITE patternPS000270258281IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MEQQLPLLAP DSKAATSSPL CLTLDNPTST STSPAVPSSA PPPAAALEPS RQSFHERETD  60
AIKAKIMSHP LYPALLRAFI DCQKVGAPPE VVGRLSALAG ELDSRAEDRH LQGQSSDPEL  120
DEFMETYIDM LVSYRQELTR PIQEADQFFR NMEAQIDSFT LDDNGSEGGN SSEDEQEAGG  180
GDMASAGLPE ITSPCAEDKE LKSHLLNKYS GYLSSLWREL SKKKKKGKLP RDARQKLLHW  240
WQLHYRWPYP SELEKAALAE STGLDAKQIN NWFINQRKRH WKPTPPAMEY RSLQPAGAAS  300
YGGASAGAST SGGGSAVVRG MEGQHFTGGG AYPRGGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6950030.0HQ695003.1 Oryza sativa fused compound leaf 1 (FCL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628832.10.0PREDICTED: homeobox protein knotted-1-like 4
SwissprotQ75LX70.0KNOS4_ORYSJ; Homeobox protein knotted-1-like 4
TrEMBLA0A0D9ZBF90.0A0A0D9ZBF9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA010073-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-84KNOTTED-like from Arabidopsis thaliana